Host taxon 9606
Protein NP_001012523.1
forkhead box protein P1 isoform b
Homo sapiens
Gene FOXP1, UniProt Q9H334
>NP_001012523.1|Haemophilus ducreyi 35000HP|forkhead box protein P1 isoform b
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.51 | 0.511905411377443 | 5.2e-5 | 31213562 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)