Host taxon 9606
Protein NP_001191431.1
fms-related tyrosine kinase 3 ligand isoform 1 precursor
Homo sapiens
Gene FLT3LG, UniProt P49771
>NP_001191431.1|Haemophilus ducreyi 35000HP|fms-related tyrosine kinase 3 ligand isoform 1 precursor
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.98 | 0.982469048272494 | 0.0032 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)