Host taxon 9606
Protein NP_114156.1
fibroblast growth factor-binding protein 2 precursor
Homo sapiens
Gene FGFBP2, UniProt Q9BYJ0
>NP_114156.1|Haemophilus ducreyi 35000HP|fibroblast growth factor-binding protein 2 precursor
MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.78 | -2.77842855231681 | 1.0e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)