Host taxon 9606
Protein NP_001026904.2
ferredoxin-2, mitochondrial precursor
Homo sapiens
Gene FDX2, UniProt Q6P4F2
>NP_001026904.2|Haemophilus ducreyi 35000HP|ferredoxin-2, mitochondrial precursor
MHVMAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.85 | 0.853940998449402 | 0.02 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)