Host taxon 9606
Protein NP_001129587.1
F-box only protein 28 isoform b
Homo sapiens
Gene FBXO28, UniProt Q9NVF7
>NP_001129587.1|Haemophilus ducreyi 35000HP|F-box only protein 28 isoform b
MAAAAEERMAEEGGGGQGDGGSSLASGSTQRQPPPPAPQHPQPGSQALPAPALAPDQLPQNNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQVKAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKFQDRLQP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.58 | -0.583507844618935 | 0.0032 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)