Host taxon 9606
Protein NP_976307.2
F-box and leucine-rich protein 22 isoform 1
Homo sapiens
Gene FBXL22, UniProt Q6P050
>NP_976307.2|Haemophilus ducreyi 35000HP|F-box and leucine-rich protein 22 isoform 1
MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.65 | -0.645091532074568 | 0.025 | 31213562 | |
Retrieved 1 of 2 entries in 1.4 ms
(Link to these results)