Host taxon 9606
Protein NP_004087.1
eukaryotic translation initiation factor 4E-binding protein 2
Homo sapiens
Gene EIF4EBP2, UniProt Q13542
>NP_004087.1|Haemophilus ducreyi 35000HP|eukaryotic translation initiation factor 4E-binding protein 2
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.47 | -0.468555615511536 | 0.00078 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)