Host taxon 9606
Protein NP_004086.1
eukaryotic translation initiation factor 4E-binding protein 1
Homo sapiens
Gene EIF4EBP1, UniProt Q13541
>NP_004086.1|Haemophilus ducreyi 35000HP|eukaryotic translation initiation factor 4E-binding protein 1
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.99 | 1.99042257411124 | 1.4e-13 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)