Host taxon 9606
Protein NP_001263265.1
eukaryotic translation initiation factor 4E type 2 isoform C
Homo sapiens
Gene EIF4E2, UniProt O60573
>NP_001263265.1|Haemophilus ducreyi 35000HP|eukaryotic translation initiation factor 4E type 2 isoform C
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.74 | 0.738441940491945 | 0.00097 | 31213562 | |
Retrieved 1 of 4 entries in 1.6 ms
(Link to these results)