Host taxon 9606
Protein NP_001271264.1
eukaryotic translation initiation factor 3 subunit J isoform 2
Homo sapiens
Gene EIF3J, UniProt O75822
>NP_001271264.1|Haemophilus ducreyi 35000HP|eukaryotic translation initiation factor 3 subunit J isoform 2
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFVEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.48 | 0.483552345216073 | 0.0082 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)