Host taxon 9606
Protein NP_005792.1
eukaryotic translation initiation factor 1
Homo sapiens
Gene EIF1, UniProt P41567
>NP_005792.1|Haemophilus ducreyi 35000HP|eukaryotic translation initiation factor 1
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.59 | 0.585975489830965 | 0.0066 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)