Host taxon 9606
Protein NP_001135760.1
ER membrane protein complex subunit 8 isoform 2
Homo sapiens
Gene EMC8, UniProt O43402
>NP_001135760.1|Haemophilus ducreyi 35000HP|ER membrane protein complex subunit 8 isoform 2
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.73 | 0.73402222276172 | 1.7e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)