Host taxon 9606
Protein NP_001273349.1
ER membrane protein complex subunit 4 isoform b
Homo sapiens
Gene EMC4, UniProt Q5J8M3
>NP_001273349.1|Haemophilus ducreyi 35000HP|ER membrane protein complex subunit 4 isoform b
MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISAKNGVQWWRTAFVNMRKQRLVPMYLGLIYILL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.75 | 0.746080891343006 | 0.0031 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)