Host taxon 9606
Protein NP_001415.1
epithelial membrane protein 2 precursor
Homo sapiens
Gene EMP2, UniProt P54851
>NP_001415.1|Haemophilus ducreyi 35000HP|epithelial membrane protein 2 precursor
MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.75 | -0.74519954551716 | 0.028 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)