Host taxon 9606
Protein NP_001257918.1
epigen isoform 1 precursor
Homo sapiens
Gene EPGN, UniProt Q6UW88
>NP_001257918.1|Haemophilus ducreyi 35000HP|epigen isoform 1 precursor
MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRCLKLKSPYNVCSGERRPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.56 | 4.5611734578014 | 6.1e-19 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)