Host taxon 9606
Protein NP_005218.1
ephrin-A4 isoform a precursor
Homo sapiens
Gene EFNA4, UniProt P52798
>NP_005218.1|Haemophilus ducreyi 35000HP|ephrin-A4 isoform a precursor
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.84 | -0.83968951988356 | 3.3e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)