Host taxon 9606
Protein NP_001034548.1
engulfment and cell motility protein 1 isoform 2
Homo sapiens
Gene ELMO1, UniProt Q92556
>NP_001034548.1|Haemophilus ducreyi 35000HP|engulfment and cell motility protein 1 isoform 2
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.02 | 1.02073457655718 | 8.6e-8 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)