Host taxon 9606
Protein NP_001029197.1
endoplasmic reticulum resident protein 29 isoform 2 precursor
Homo sapiens
Gene ERP29, UniProt P30040
>NP_001029197.1|Haemophilus ducreyi 35000HP|endoplasmic reticulum resident protein 29 isoform 2 precursor
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKIMVTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.68 | 0.678455875536915 | 0.0094 | 31213562 | |
Retrieved 1 of 2 entries in 1.5 ms
(Link to these results)