Host taxon 9606
Protein NP_001287713.1
endoplasmic reticulum resident protein 27 isoform 2
Homo sapiens
Gene ERP27, UniProt Q96DN0
>NP_001287713.1|Haemophilus ducreyi 35000HP|endoplasmic reticulum resident protein 27 isoform 2
MKETCQLEIQVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.67 | 1.66803301086893 | 1.4e-7 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)