Host taxon 9606
Protein NP_006005.2
EKC/KEOPS complex subunit LAGE3
Homo sapiens
Gene LAGE3, UniProt Q14657
>NP_006005.2|Haemophilus ducreyi 35000HP|EKC/KEOPS complex subunit LAGE3
MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.83 | 0.829666706699388 | 0.019 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)