Host taxon 9606
Protein NP_001136329.1
EF-hand calcium-binding domain-containing protein 1 isoform b
Homo sapiens
Gene EFCAB1, UniProt Q9HAE3
>NP_001136329.1|Haemophilus ducreyi 35000HP|EF-hand calcium-binding domain-containing protein 1 isoform b
MNRKKLQKLTDTLTKNCKHLFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.88 | -1.88121894494644 | 3.9e-8 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)