Host taxon 9606
Protein NP_001243787.1
E3 ubiquitin-protein ligase RNF34 isoform 3
Homo sapiens
Gene RNF34, UniProt Q969K3
>NP_001243787.1|Haemophilus ducreyi 35000HP|E3 ubiquitin-protein ligase RNF34 isoform 3
MKGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQYVVRAVHVFKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.85 | 0.850781842370013 | 9.5e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)