Host taxon 9606
Protein NP_057578.1
E3 ubiquitin-protein ligase RNF181
Homo sapiens
Gene RNF181, UniProt Q9P0P0
>NP_057578.1|Haemophilus ducreyi 35000HP|E3 ubiquitin-protein ligase RNF181
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.47 | 1.47430352708718 | 2.7e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)