Host taxon 9606
Protein NP_001243687.1
E3 ubiquitin-protein ligase RNF165 isoform 2
Homo sapiens
Gene RNF165, UniProt Q6ZSG1
>NP_001243687.1|Haemophilus ducreyi 35000HP|E3 ubiquitin-protein ligase RNF165 isoform 2
MHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIETQLGADS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.46 | -1.46065104616838 | 0.00047 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)