Host taxon 9606
Protein NP_001036075.1
dysbindin domain-containing protein 1 isoform 1
Homo sapiens
Gene DBNDD1, UniProt Q9H9R9
>NP_001036075.1|Haemophilus ducreyi 35000HP|dysbindin domain-containing protein 1 isoform 1
MEPPEGAGTGEIVKEAEVPQAALGVPAQGTGDNGHTPVEEEVGGIPVPAPGLLQVTERRQPLSSVSSLEVHFDLLDLTELTDMSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVERPQED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.6 | -0.59509362719936 | 0.039 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)