Host taxon 9606
Protein NP_006511.1
dynein light chain Tctex-type 3
Homo sapiens
Gene DYNLT3, UniProt P51808
>NP_006511.1|Haemophilus ducreyi 35000HP|dynein light chain Tctex-type 3
MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.87 | 0.871855774101568 | 8.4e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)