Host taxon 9606
Protein NP_006510.1
dynein light chain Tctex-type 1 isoform 1
Homo sapiens
Gene DYNLT1, UniProt P63172
>NP_006510.1|Haemophilus ducreyi 35000HP|dynein light chain Tctex-type 1 isoform 1
MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.29 | 2.28751637589598 | 1.9e-8 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)