Host taxon 9606
Protein NP_001335.1
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Homo sapiens
Gene DAD1, UniProt P61803
>NP_001335.1|Haemophilus ducreyi 35000HP|dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.29 | 1.28565488700974 | 5.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)