Host taxon 9606
Protein NP_001128165.1
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
Homo sapiens
Gene OST4, UniProt P0C6T2
>NP_001128165.1|Haemophilus ducreyi 35000HP|dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.46 | 1.46235215066697 | 4.3e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)