Host taxon 9606
Protein NP_001287843.1
dnaJ homolog subfamily B member 1 isoform 2
Homo sapiens
Gene DNAJB1, UniProt P25685
>NP_001287843.1|Haemophilus ducreyi 35000HP|dnaJ homolog subfamily B member 1 isoform 2
MFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.68 | 0.677870519036249 | 0.028 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)