Host taxon 9606
Protein NP_005025.1
DNA-directed RNA polymerases I, II, and III subunit RPABC4
Homo sapiens
Gene POLR2K, UniProt P53803
>NP_005025.1|Haemophilus ducreyi 35000HP|DNA-directed RNA polymerases I, II, and III subunit RPABC4
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.54 | 0.541053939228654 | 0.026 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)