Host taxon 9606
Protein NP_057394.3
DNA-directed RNA polymerase III subunit RPC10
Homo sapiens
Gene POLR3K, UniProt Q9Y2Y1
>NP_057394.3|Haemophilus ducreyi 35000HP|DNA-directed RNA polymerase III subunit RPC10
MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.95 | 0.950324301244515 | 0.00033 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)