Host taxon 9606
Protein NP_001091084.2
DNA-directed RNA polymerase II subunit RPB11-b2
Homo sapiens
Gene POLR2J3, UniProt A0A0B4J2F8
>NP_001091084.2|Haemophilus ducreyi 35000HP|DNA-directed RNA polymerase II subunit RPB11-b2
MNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.5 | -0.49725947960822 | 0.039 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)