Host taxon 9606
Protein NP_001243799.1
DNA polymerase delta subunit 4 isoform 2
Homo sapiens
Gene POLD4, UniProt Q9HCU8
>NP_001243799.1|Haemophilus ducreyi 35000HP|DNA polymerase delta subunit 4 isoform 2
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTVSGISIPYEAPRKTSCP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.876707334864043 | 0.013 | 31213562 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)