Host taxon 9606
Protein NP_001006667.1
DNA dC->dU-editing enzyme APOBEC-3F isoform b
Homo sapiens
Gene APOBEC3F, UniProt Q8IUX4
>NP_001006667.1|Haemophilus ducreyi 35000HP|DNA dC->dU-editing enzyme APOBEC-3F isoform b
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.13 | 1.12702071686448 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)