Host taxon 9606
Protein NP_001181982.1
DNA damage-inducible transcript 3 protein isoform 1
Homo sapiens
Gene DDIT3, UniProt P35638
>NP_001181982.1|Haemophilus ducreyi 35000HP|DNA damage-inducible transcript 3 protein isoform 1
MELVPATPHYPADVLFQTDPTAEMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.14 | 1.13525446145749 | 3.5e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)