Host taxon 9606
Protein NP_001135444.1
diphthine--ammonia ligase isoform 2
Homo sapiens
Gene DPH6, UniProt Q7L8W6
>NP_001135444.1|Haemophilus ducreyi 35000HP|diphthine--ammonia ligase isoform 2
MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKGITRMTLLAEYDALNLQDFHMHLKVGSQAIVYRTPNELCTHSKFDKHTFPPFISEIAKCEV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.72 | -0.716880648170794 | 0.045 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)