Host taxon 9606
Protein NP_001107645.1
dipeptidyl peptidase 1 isoform c precursor
Homo sapiens
Gene CTSC, UniProt P53634
>NP_001107645.1|Haemophilus ducreyi 35000HP|dipeptidyl peptidase 1 isoform c precursor
MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKDVTDFISHLFMQLGTVGIYDLPHLRNKLAMNRRWG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.27 | 2.2678026826128 | 7.2e-15 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)