Host taxon 9606
Protein NP_001305788.1
deoxyguanosine kinase, mitochondrial isoform c precursor
Homo sapiens
Gene DGUOK, UniProt Q16854
>NP_001305788.1|Haemophilus ducreyi 35000HP|deoxyguanosine kinase, mitochondrial isoform c precursor
MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.88 | 0.880872795591896 | 0.00011 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)