Host taxon 9606
Protein NP_001017920.2
death-associated protein-like 1
Homo sapiens
Gene DAPL1, UniProt A0PJW8
>NP_001017920.2|Haemophilus ducreyi 35000HP|death-associated protein-like 1
MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.86 | -1.85589474887377 | 0.013 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)