Host taxon 9606
Protein NP_001014812.1
cytosolic iron-sulfur assembly component 2A isoform b precursor
Homo sapiens
Gene CIAO2A, UniProt Q9H5X1
>NP_001014812.1|Haemophilus ducreyi 35000HP|cytosolic iron-sulfur assembly component 2A isoform b precursor
MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIVGNLHF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.37 | 1.37492059316145 | 2.1e-8 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)