Host taxon 9606
Protein NP_002480.1
cytochrome c oxidase subunit NDUFA4
Homo sapiens
Gene NDUFA4, UniProt O00483
>NP_002480.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase subunit NDUFA4
MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.93 | 0.926018130320188 | 0.00011 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)