Host taxon 9606
Protein NP_001305965.1
cytochrome c oxidase subunit 7A-related protein, mitochondrial isoform a
Homo sapiens
Gene COX7A2L, UniProt O14548
>NP_001305965.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase subunit 7A-related protein, mitochondrial isoform a
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.43 | 0.426808586283247 | 0.014 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)