Host taxon 9606
Protein NP_004365.1
cytochrome c oxidase subunit 6C
Homo sapiens
Gene COX6C, UniProt P09669
>NP_004365.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase subunit 6C
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.15 | 1.15100906180068 | 8.5e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)