Host taxon 9606
Protein NP_004364.2
cytochrome c oxidase subunit 6A1, mitochondrial
Homo sapiens
Gene COX6A1, UniProt P12074
>NP_004364.2|Haemophilus ducreyi 35000HP|cytochrome c oxidase subunit 6A1, mitochondrial
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.8 | 0.795528972783862 | 0.025 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)