Host taxon 9606
Protein NP_001305715.1
cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 1 precursor
Homo sapiens
Gene COX4I1, UniProt P13073
>NP_001305715.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 1 precursor
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.83 | 0.832316274311566 | 0.0094 | 31213562 | |
Retrieved 1 of 3 entries in 2 ms
(Link to these results)