Host taxon 9606
Protein NP_057552.1
cytochrome c oxidase assembly protein COX16 homolog, mitochondrial isoform 1 precursor
Homo sapiens
Gene COX16, UniProt Q9P0S2
>NP_057552.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase assembly protein COX16 homolog, mitochondrial isoform 1 precursor
MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.65 | 0.648946800022519 | 0.043 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)