Host taxon 9606
Protein NP_001244062.1
cytochrome c oxidase assembly protein COX14
Homo sapiens
Gene COX14, UniProt Q96I36
>NP_001244062.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase assembly protein COX14
MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.66 | 0.662167874761305 | 0.0089 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)