Host taxon 9606
Protein NP_001013003.1
cytochrome c oxidase assembly factor 6 homolog isoform 1
Homo sapiens
Gene COA6, UniProt Q5JTJ3
>NP_001013003.1|Haemophilus ducreyi 35000HP|cytochrome c oxidase assembly factor 6 homolog isoform 1
MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.33 | 1.3252825005722 | 0.0014 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)