Host taxon 9606
Protein NP_055217.2
cytochrome b-c1 complex subunit 8
Homo sapiens
Gene UQCRQ, UniProt O14949
>NP_055217.2|Haemophilus ducreyi 35000HP|cytochrome b-c1 complex subunit 8
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.97 | 0.971713741565244 | 0.0019 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)